Skip to main content

Table 4 Sequence analysis of the C9 scFv phage clone and its CDRs region

From: Isolation and characterizations of a novel recombinant scFv antibody against exotoxin A of Pseudomonas aeruginosa

C9 sequence MKYLLPTAAAGLLLLAAQPAMAEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRRAPGKGLEWVSTISSSGSATSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTASSFDYWGQGTLVTVSSGGGGSGGGGSGGGGSTDIQITQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYNASYLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNAGPTTFGQGTKVEIKRAAAHHHHHHGAAEQKLISEEDLNGAA
VL/VH VL VH
CDR1 GFTFSSYA QSISSY
CDR2 ISSSGSAT NASYLQSGVPS
CDR3 AKTASSFDY QQSNAGPTT