Skip to main content

Table 1 Overlapping epitopes predicted by three methods

From: A novel multi-epitope recombined protein for diagnosis of human brucellosis

Protein Start–end position Sequence
BP26 87–124 KKAGIEDRDLQTGGINIQPIYVYPDDKNNLKEPTITGY
151–170 GVNQGGDLNL VNDNPSAVIN
223–245 AAAPDNSV PIAAGENSYNVSVNV
OMP31 24–40 VSEPSAP TAAPVDTFSW
48-83 NAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFV
109–129 SS VTGSISAGAS GLEGKAETK
168–225 GDD ASALHTWSD KTKAGWTLGAGA EYAINNNWTLKSEYLYTDLGKRNLVDVDNSFLES
OMP16 90–106 Q YSITIEGHAD ERGTRE
124–146 ASRGVPT NRMRTISYGN ERPVAV
OMP2b 66–84 DVKGG DDVYSGTDRN GWDK
194–210 ALEQGGD NDGGYTGTTN
242–282 VIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWG
268–286 YSS AATPDQNYGQ WGGDWA
306–316 FNLQAAHDDW GKTAVTAN
328–354 TVT PEVSYTKFGG EWKDTVAEDN AWGG